PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234624.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 548aa    MW: 61607.9 Da    PI: 5.0426
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234624.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.13e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp GfrF+Ptdeel+++yL+ k++g++ ++ +vi+e+d++k+ePwdLp  + +++++ ew+fF+++d+ky++g+r nrat +gyWkatgkd++++
  XP_008234624.1  14 LPLGFRFRPTDEELIDYYLRSKINGNHKQV-TVIREIDVCKWEPWDLPdlSVIRTTDPEWFFFCPQDRKYPNGHRLNRATGRGYWKATGKDRQIK 107
                     699************************999.99**************96447777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s  + l+g+kktLvf++grapkg++t+Wvmheyr 
  XP_008234624.1 108 S-ATILIGMKKTLVFHTGRAPKGKRTNWVMHEYRT 141
                     *.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-617164IPR003441NAC domain
PROSITE profilePS5100556.00214164IPR003441NAC domain
PfamPF023651.9E-2715140IPR003441NAC domain
CDDcd016100.00852478536No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MLVVDMTVLS TNTLPLGFRF RPTDEELIDY YLRSKINGNH KQVTVIREID VCKWEPWDLP  60
DLSVIRTTDP EWFFFCPQDR KYPNGHRLNR ATGRGYWKAT GKDRQIKSAT ILIGMKKTLV  120
FHTGRAPKGK RTNWVMHEYR TTQKELDGTN PGQNPFVLCR LFKKQDETIE DSNLAEVEPT  180
VSSPTAAISS PQDTQSDHAL GPASPSFERN EKPTKVECTT ADCSNGMEPD TLQPIECPSN  240
CYNGYDAEDQ LNVPLEELDI FYDPPQQPLF SPLHSQMQTE LYYCGSNNFN NGHQGVKFQY  300
GTNDQDADIS EFLSSIFNSS GEHSDVDAKV AVPCETEFQN PVQSEGNIDR KGPVQNESTR  360
IDCDQSSMFR VTSNHSNVFL SGDAGNGIRL RARKTQNLTS TENFARQGDA PRRLRLQRKV  420
LYCSNLSKDW NCRPEDRETK PMAVEEIRDT EEKAVDAAVS DAVDAATDPP KKETMSTRPN  480
FTPEGSILTG ERVPNVILQA SPAGHSMWSF AFLFRVVVVV AFLFIMLLAY GDFISFDAAG  540
SPFTARMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-4611654166NAC domain-containing protein 19
4dul_A5e-4611654166NAC domain-containing protein 19
1ut7_B5e-4611654166NO APICAL MERISTEM PROTEIN
1ut7_A5e-4611654166NO APICAL MERISTEM PROTEIN
1ut4_B5e-4611654166NO APICAL MERISTEM PROTEIN
1ut4_A5e-4611654166NO APICAL MERISTEM PROTEIN
3swp_D6e-4611657169NAC domain-containing protein 19
3swp_C6e-4611657169NAC domain-containing protein 19
3swp_B6e-4611657169NAC domain-containing protein 19
3swp_A6e-4611657169NAC domain-containing protein 19
3swm_D6e-4611657169NAC domain-containing protein 19
3swm_C6e-4611657169NAC domain-containing protein 19
3swm_B6e-4611657169NAC domain-containing protein 19
3swm_A6e-4611657169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234624.10.0PREDICTED: NAC domain-containing protein 7-like
TrEMBLD9ZJ910.0D9ZJ91_MALDO; NAC domain class transcription factor
STRINGGLYMA14G36840.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.21e-112TCV-interacting protein